Structure of PDB 4v4y Chain B3

Receptor sequence
>4v4yB3 (length=71) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MKEGIHPKLVPARIICGCGNVIETYSTKPEIYVEVCSKCHPFYTGQQRFV
DTEGRVERFQRRYGDSYRKGR
3D structure
PDB4v4y Structural basis for messenger RNA movement on the ribosome.
ChainB3
Resolution5.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B3 I22 E30 I22 E30
BS02 rna B3 M1 K2 E3 V10 R13 I15 C16 E23 T24 S26 T27 K28 P29 E30 I31 Y32 E34 V35 C39 H40 P41 F42 T44 R58 F59 Y63 Y67 M1 K2 E3 V10 R13 I15 C16 E23 T24 S26 T27 K28 P29 E30 I31 Y32 E34 V35 C39 H40 P41 F42 T44 R58 F59 Y63 Y67
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v4y, PDBe:4v4y, PDBj:4v4y
PDBsum4v4y
PubMed17051149
UniProtQ5SJE1|RL31_THET8 Large ribosomal subunit protein bL31 (Gene Name=rpmE)

[Back to BioLiP]