Structure of PDB 3j9w Chain B3 |
>3j9wB3 (length=64) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] |
MKAGIHPNFKKATVKCACGNEFETGSVKEEVRVEICSECHPFYTGRQKFA SADGRVDRFNKKYG |
|
PDB | 3j9w Structure of the Bacillus subtilis 70S ribosome reveals the basis for species-specific stalling. |
Chain | B3 |
Resolution | 3.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
B3 |
M1 K2 H6 |
M1 K2 H6 |
|
|
|
|