Structure of PDB 6tui Chain B2 |
>6tuiB2 (length=84) Species: 272942 (Rhodobacter capsulatus SB 1003) [Search protein sequence] |
MDVFAKHAVSLESPAVRHYEITPSDSTDLARRPRALRVQTGGTLVLRDET GITVTYTVFAGEILPVRPVRVLATGTTATAVGWE |
|
PDB | 6tui Virion of empty GTA particle |
Chain | B2 |
Resolution | 10.47 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
B2 |
E12 P65 |
E12 P65 |
|
|
|