Structure of PDB 6tb9 Chain B2 |
>6tb9B2 (length=84) Species: 1061 (Rhodobacter capsulatus) [Search protein sequence] |
MDVFAKHAVSLESPAVRHYEITPSDSTDLARRPRALRVQTGGTLVLRDET GITVTYTVFAGEILPVRPVRVLATGTTATAVGWE |
|
PDB | 6tb9 Structure and mechanism of DNA delivery of a gene transfer agent. |
Chain | B2 |
Resolution | 3.56 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
B2 |
E12 A15 P65 |
E12 A15 P65 |
|
|
|