Structure of PDB 5aj4 Chain B2

Receptor sequence
>5aj4B2 (length=178) Species: 9823 (Sus scrofa) [Search protein sequence]
LEEFFDDPKNWGEEKVKSGASWTCQQLRNKSNEDLHKLWYVLLKERNMLL
TLEQEAKRQRLPMPSPERLEKVVDSMDALDKVVQEREDALRLLQTGQEKA
RPGAWRRDIFGRIIWHKFKQWPIPWYLNKKYNRKRFFAMPYVERFVRMRI
EKQARIKARKRSLERKKEKFLQEKFPHL
3D structure
PDB5aj4 The complete structure of the 55S mammalian mitochondrial ribosome.
ChainB2
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B2 K122 R123 R125 R166 I174 K182 K184 P187 I188 Y191 L192 N193 K194 N197 R198 K199 R200 F202 M204 R224 K232 K234 K57 R58 R60 R101 I109 K117 K119 P122 I123 Y126 L127 N128 K129 N132 R133 K134 R135 F137 M139 R159 K167 K169
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Thu Mar 13 16:13:01 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5aj4', asym_id = 'B2', title = 'The complete structure of the 55S mammalian mitochondrial ribosome.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5aj4', asym_id='B2', title='The complete structure of the 55S mammalian mitochondrial ribosome.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005761,0006412', uniprot = '', pdbid = '5aj4', asym_id = 'B2'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005761,0006412', uniprot='', pdbid='5aj4', asym_id='B2')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>