Structure of PDB 4v7z Chain B2

Receptor sequence
>4v7zB2 (length=50) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
EARKLSPVELEKLVREKKRELMELRFQASIGQLSQNHKIRDLKRQIARLL
3D structure
PDB4v7z Revisiting the structures of several antibiotics bound to the bacterial ribosome.
ChainB2
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna B2 L32 Q38 A39 S40 I41 H48 K49 R51 D52 L53 R55 Q56 L21 Q27 A28 S29 I30 H37 K38 R40 D41 L42 R44 Q45
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v7z, PDBe:4v7z, PDBj:4v7z
PDBsum4v7z
PubMed20876130
UniProtQ5SHP6|RL29_THET8 Large ribosomal subunit protein uL29 (Gene Name=rpmC)

[Back to BioLiP]