Structure of PDB 4v5s Chain B2

Receptor sequence
>4v5sB2 (length=71) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
KLSEVRKQLEEARKLSPVELEKLVREKKRELMELRFQASIGQLSQNHKIR
DLKRQIARLLTVLNEKRRQNA
3D structure
PDB4v5s How Mutations in tRNA Distant from the Anticodon Affect the Fidelity of Decoding.
ChainB2
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B2 K2 L3 S4 R14 Q46 N47 H48 R51 D52 K54 L61 T62 N65 K1 L2 S3 R13 Q45 N46 H47 R50 D51 K53 L60 T61 N64
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v5s, PDBe:4v5s, PDBj:4v5s
PDBsum4v5s
PubMed21378964
UniProtQ5SHP6|RL29_THET8 Large ribosomal subunit protein uL29 (Gene Name=rpmC)

[Back to BioLiP]