Structure of PDB 4v5c Chain B2

Receptor sequence
>4v5cB2 (length=71) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
KLSEVRKQLEEARKLSPVELEKLVREKKRELMELRFQASIGQLSQNHKIR
DLKRQIARLLTVLNEKRRQNA
3D structure
PDB4v5c Insights Into Substrate Stabilization from Snapshots of the Peptidyl Transferase Center of the Intact 70S Ribosome
ChainB2
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna B2 K2 L3 R14 Q46 N47 H48 R51 K54 R55 A58 R59 L61 T62 R69 K1 L2 R13 Q45 N46 H47 R50 K53 R54 A57 R58 L60 T61 R68
BS02 MG B2 R36 K54 R35 K53
BS03 MG B2 R55 Q56 R59 R54 Q55 R58
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v5c, PDBe:4v5c, PDBj:4v5c
PDBsum4v5c
PubMed19363482
UniProtQ5SHP6|RL29_THET8 Large ribosomal subunit protein uL29 (Gene Name=rpmC)

[Back to BioLiP]