Structure of PDB 4v4t Chain B2

Receptor sequence
>4v4tB2 (length=64) Species: 274 (Thermus thermophilus) [Search protein sequence]
TVLHVQEIRDMTPAEREAELDDLKTELLNARVQAAGGAPENPGRIKELRK
AIARIKTIQGEEGD
3D structure
PDB4v4t Crystal Structures of the Ribosome in Complex with Release Factors RF1 and RF2 Bound to a Cognate Stop Codon.
ChainB2
Resolution6.46 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B2 T1 E41 N42 K47 R50 K51 A54 R55 K57 T58 E62 T1 E40 N41 K46 R49 K50 A53 R54 K56 T57 E61
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v4t, PDBe:4v4t, PDBj:4v4t
PDBsum4v4t
PubMed16377566
UniProtP10971|RL29_HALMA Large ribosomal subunit protein uL29 (Gene Name=rpl29)

[Back to BioLiP]