Structure of PDB 3j9w Chain B2

Receptor sequence
>3j9wB2 (length=58) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
AKLEITLKRSVIGRPEDQRVTVRTLGLKKTNQTVVHEDNAAIRGMINKVS
HLVSVKEQ
3D structure
PDB3j9w Structure of the Bacillus subtilis 70S ribosome reveals the basis for species-specific stalling.
ChainB2
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B2 R10 S11 I13 R15 P16 E17 R20 V21 T25 K29 K30 T31 E38 A42 I43 G45 M46 K49 R9 S10 I12 R14 P15 E16 R19 V20 T24 K28 K29 T30 E37 A41 I42 G44 M45 K48
BS02 rna B2 Q19 H52 Q18 H51
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j9w, PDBe:3j9w, PDBj:3j9w
PDBsum3j9w
PubMed25903689
UniProtP19947|RL30_BACSU Large ribosomal subunit protein uL30 (Gene Name=rpmD)

[Back to BioLiP]