Structure of PDB 7lh5 Chain B1

Receptor sequence
>7lh5B1 (length=88) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
SGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRVRVAGQE
ITFRVAASHIPKVYELVERAKGLKLEGLSPKEIKKELL
3D structure
PDB7lh5 Structural basis for plazomicin antibiotic action and resistance.
ChainB1
Resolution3.27 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B1 E27 K32 E20 K25
BS02 rna B1 S8 I18 Q19 R20 R21 G29 G31 K32 K33 T34 T35 G36 I37 S38 R40 Y43 P44 N45 L46 Q47 V49 R50 R52 S65 H66 K69 A77 K88 L95 S1 I11 Q12 R13 R14 G22 G24 K25 K26 T27 T28 G29 I30 S31 R33 Y36 P37 N38 L39 Q40 V42 R43 R45 S58 H59 K62 A70 K81 L88
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7lh5, PDBe:7lh5, PDBj:7lh5
PDBsum7lh5
PubMed34117352
UniProtP60494|RL28_THET8 Large ribosomal subunit protein bL28 (Gene Name=rpmB)

[Back to BioLiP]