Structure of PDB 4v9j Chain B1

Receptor sequence

>4v9jB1 (length=93) Species: 262724 (Thermus thermophilus HB27)

KVCEISGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRVR
VAGQEITFRVAASHIPKVYELVERAKGLKLEGLSPKEIKKELL

3D structure

• PDB: 4v9j Crystal structures of EF-G-ribosome complexes trapped in intermediate states of translocation.
• Chain: B1
• Resolution: 3.86 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B1	K32 K33	K30 K31
BS02	rna	B1	K3 K10 R11 A15 N16 I18 Q19 R20 R21 K25 R26 G29 V30 T35 I37 Q42 Y43 P44 N45 Q47 R50 R52 A64 S65 H66 P68 K69 R76 G79 K88	K1 K8 R9 A13 N14 I16 Q17 R18 R19 K23 R24 G27 V28 T33 I35 Q40 Y41 P42 N43 Q45 R48 R50 A62 S63 H64 P66 K67 R74 G77 K86

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v9j, PDBe:4v9j, PDBj:4v9j
• PDBsum: 4v9j
• PubMed: 23812722
• UniProt: Q72G84|RL28_THET2 Large ribosomal subunit protein bL28 (Gene Name=rpmB)