Structure of PDB 4v8u Chain B1

Receptor sequence

>4v8uB1 (length=93) Species: 300852 (Thermus thermophilus HB8)

KVCEISGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRVR
VAGQEITFRVAASHIPKVYELVERAKGLKLEGLSPKEIKKELL

3D structure

• PDB: 4v8u Crystal structure of 70S ribosome with both cognate tRNAs in the E and P sites representing an authentic elongation complex.
• Chain: B1
• Resolution: 3.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B1	K3 K10 I13 V14 A15 N16 R20 A24 K25 V30 K33 T34 T35 I37 S38 K39 R40 R41 Q42 Y43 P44 N45 Q47 K48 R50 R52 R61 H66 I67 P68 K69 K81 E89 K92 E93	K1 K8 I11 V12 A13 N14 R18 A22 K23 V28 K31 T32 T33 I35 S36 K37 R38 R39 Q40 Y41 P42 N43 Q45 K46 R48 R50 R59 H64 I65 P66 K67 K79 E87 K90 E91

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v8u, PDBe:4v8u, PDBj:4v8u
• PDBsum: 4v8u
• PubMed: 23527033
• UniProt: P60494|RL28_THET8 Large ribosomal subunit protein bL28 (Gene Name=rpmB)