Structure of PDB 4v7z Chain B1

Receptor sequence

>4v7zB1 (length=88) Species: 300852 (Thermus thermophilus HB8)

SGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRVRVAGQE
ITFRVAASHIPKVYELVERAKGLKLEGLSPKEIKKELL

3D structure

• PDB: 4v7z Revisiting the structures of several antibiotics bound to the bacterial ribosome.
• Chain: B1
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B1	S8 I18 Q19 R20 R21 K23 G28 G31 K32 K33 T34 T35 G36 I37 S38 K39 R40 R41 Y43 P44 N45 L46 Q47 V49 R52 R61 S65 H66 K69 R76 K78 K88 E93	S1 I11 Q12 R13 R14 K16 G21 G24 K25 K26 T27 T28 G29 I30 S31 K32 R33 R34 Y36 P37 N38 L39 Q40 V42 R45 R54 S58 H59 K62 R69 K71 K81 E86

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v7z, PDBe:4v7z, PDBj:4v7z
• PDBsum: 4v7z
• PubMed: 20876130
• UniProt: P60494|RL28_THET8 Large ribosomal subunit protein bL28 (Gene Name=rpmB)