Structure of PDB 4v7x Chain B1

Receptor sequence
>4v7xB1 (length=88) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
SGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRVRVAGQE
ITFRVAASHIPKVYELVERAKGLKLEGLSPKEIKKELL
3D structure
PDB4v7x Revisiting the structures of several antibiotics bound to the bacterial ribosome.
ChainB1
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B1 S8 I18 Q19 R20 R21 K23 G28 G29 G31 K32 K33 T34 T35 I37 S38 K39 R40 R41 Q42 Y43 P44 N45 L46 Q47 V49 R52 R61 S65 K69 R76 K88 S1 I11 Q12 R13 R14 K16 G21 G22 G24 K25 K26 T27 T28 I30 S31 K32 R33 R34 Q35 Y36 P37 N38 L39 Q40 V42 R45 R54 S58 K62 R69 K81
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v7x, PDBe:4v7x, PDBj:4v7x
PDBsum4v7x
PubMed20876130
UniProtP60494|RL28_THET8 Large ribosomal subunit protein bL28 (Gene Name=rpmB)

[Back to BioLiP]