Structure of PDB 4v67 Chain B1

Receptor sequence
>4v67B1 (length=88) Species: 274 (Thermus thermophilus) [Search protein sequence]
SGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRVRVAGQE
ITFRVAASHIPKVYELVERAKGLRLEGLSPKEIKKELL
3D structure
PDB4v67 Crystal structure of a translation termination complex formed with release factor RF2.
ChainB1
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B1 S8 I18 Q19 R20 R21 R26 G31 K32 K33 T34 T35 K39 R40 R41 Q42 Y43 P44 N45 Q47 K48 H66 K69 G79 R81 K92 S1 I11 Q12 R13 R14 R19 G24 K25 K26 T27 T28 K32 R33 R34 Q35 Y36 P37 N38 Q40 K41 H59 K62 G72 R74 K85
BS02 MG B1 I58 T59 I51 T52
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v67, PDBe:4v67, PDBj:4v67
PDBsum4v67
PubMed19064930
UniProtP60494|RL28_THET8 Large ribosomal subunit protein bL28 (Gene Name=rpmB)

[Back to BioLiP]