Structure of PDB 4v63 Chain B1

Receptor sequence
>4v63B1 (length=88) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
SGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRVRVAGQE
ITFRVAASHIPKVYELVERAKGLRLEGLSPKEIKKELL
3D structure
PDB4v63 Structural basis for translation termination on the 70S ribosome
ChainB1
Resolution3.207 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B1 S8 I18 Q19 R20 R21 K23 R26 G31 K32 K33 T34 T35 I37 S38 K39 R40 R41 Q42 Y43 P44 N45 Q47 K48 E57 S65 P68 K69 G79 R81 K92 S1 I11 Q12 R13 R14 K16 R19 G24 K25 K26 T27 T28 I30 S31 K32 R33 R34 Q35 Y36 P37 N38 Q40 K41 E50 S58 P61 K62 G72 R74 K85
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v63, PDBe:4v63, PDBj:4v63
PDBsum4v63
PubMed18596689
UniProtQ72G84|RL28_THET2 Large ribosomal subunit protein bL28 (Gene Name=rpmB)

[Back to BioLiP]