Structure of PDB 4v5r Chain B1

Receptor sequence

>4v5rB1 (length=93) Species: 300852 (Thermus thermophilus HB8)

KVCEISGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRVR
VAGQEITFRVAASHIPKVYELVERAKGLKLEGLSPKEIKKELL

3D structure

• PDB: 4v5r How Mutations in tRNA Distant from the Anticodon Affect the Fidelity of Decoding.
• Chain: B1
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B1	K3 K10 R11 I13 V14 N16 I18 Q19 R21 A24 K25 G28 V30 K32 K33 T35 I37 S38 K39 R40 R41 Q42 Y43 P44 N45 Q47 R50 R52 R61 A64 K69 K92	K1 K8 R9 I11 V12 N14 I16 Q17 R19 A22 K23 G26 V28 K30 K31 T33 I35 S36 K37 R38 R39 Q40 Y41 P42 N43 Q45 R48 R50 R59 A62 K67 K90

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v5r, PDBe:4v5r, PDBj:4v5r
• PDBsum: 4v5r
• PubMed: 21378964
• UniProt: P60494|RL28_THET8 Large ribosomal subunit protein bL28 (Gene Name=rpmB)