Structure of PDB 4v5e Chain B1

Receptor sequence

>4v5eB1 (length=93) Species: 300852 (Thermus thermophilus HB8)

KVCEISGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRVR
VAGQEITFRVAASHIPKVYELVERAKGLKLEGLSPKEIKKELL

3D structure

• PDB: 4v5e Insights Into Translational Termination from the Structure of Rf2 Bound to the Ribosome.
• Chain: B1
• Resolution: 3.45 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B1	K3 K10 R11 I13 A15 N16 I18 Q19 R20 R21 K25 G29 V30 K32 K33 T35 I37 K39 R40 R41 Q42 Y43 P44 N45 Q47 R50 R52 R61 H66 K69 R76 G79 K81 K92	K1 K8 R9 I11 A13 N14 I16 Q17 R18 R19 K23 G27 V28 K30 K31 T33 I35 K37 R38 R39 Q40 Y41 P42 N43 Q45 R48 R50 R59 H64 K67 R74 G77 K79 K90

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v5e, PDBe:4v5e, PDBj:4v5e
• PDBsum: 4v5e
• PubMed: 18988853
• UniProt: P60494|RL28_THET8 Large ribosomal subunit protein bL28 (Gene Name=rpmB)