Structure of PDB 4v4y Chain B1

Receptor sequence
>4v4yB1 (length=67) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MRKQLEEARKLSPVELEKLVREKKRELMELRFQASIGQLSQNHKIRDLKR
QIARLLTVLNEKRRQNA
3D structure
PDB4v4y Structural basis for messenger RNA movement on the ribosome.
ChainB1
Resolution5.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B1 R2 R9 L39 S40 N42 H43 I45 R46 R50 A53 R54 L56 T57 N60 R2 R9 L39 S40 N42 H43 I45 R46 R50 A53 R54 L56 T57 N60
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v4y, PDBe:4v4y, PDBj:4v4y
PDBsum4v4y
PubMed17051149
UniProtQ9LCY4|RL29_THETH Large ribosomal subunit protein uL29 (Gene Name=rpmC)

[Back to BioLiP]