Structure of PDB 1vy7 Chain B1

Receptor sequence

>1vy7B1 (length=97) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

SKVCEISGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRV
RVAGQEITFRVAASHIPKVYELVERAKGLKLEGLSPKEIKKELLKLL

3D structure

PDB

1vy7 A proton wire to couple aminoacyl-tRNA accommodation and peptide-bond formation on the ribosome.

Chain

Resolution

2.8 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	B1	K23 V30	K22 V29
BS02	rna	B1	S2 K3 K10 R11 I13 V14 A15 N16 I18 Q19 R20 A24 K25 G28 G29 V30 G31 K32 K33 T34 T35 K39 R40 R41 Q42 Y43 P44 N45 Q47 K48 R50 R52 R61 A64 S65 H66 K69 R76 G79 L80 L97	S1 K2 K9 R10 I12 V13 A14 N15 I17 Q18 R19 A23 K24 G27 G28 V29 G30 K31 K32 T33 T34 K38 R39 R40 Q41 Y42 P43 N44 Q46 K47 R49 R51 R60 A63 S64 H65 K68 R75 G78 L79 L96
BS03	MG	B1	R20 K32 K33 T34	R19 K31 K32 T33

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:1vy7, PDBe:1vy7, PDBj:1vy7
PDBsum	1vy7
PubMed	25132179
UniProt	P60494\|RL28_THET8 Large ribosomal subunit protein bL28 (Gene Name=rpmB)