Structure of PDB 4v8h Chain B0

Receptor sequence
>4v8hB0 (length=76) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
STRNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKNVGMGRDFT
LFALVDGVVEFQDRGRLGRYVHVRPL
3D structure
PDB4v8h How Hibernation Factors RMF, HPF, and YfiA Turn Off Protein Synthesis.
ChainB0
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B0 N12 R14 D15 S16 A18 K19 R20 K24 Y26 E27 Q29 R32 A33 G34 N35 I36 R39 R41 G42 T43 G54 R55 D56 F57 F60 F69 R74 L75 R77 N4 R6 D7 S8 A10 K11 R12 K16 Y18 E19 Q21 R24 A25 G26 N27 I28 R31 R33 G34 T35 G46 R47 D48 F49 F52 F61 R66 L67 R69
BS02 rna B0 R72 R74 R64 R66
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v8h, PDBe:4v8h, PDBj:4v8h
PDBsum4v8h
PubMed22605777
UniProtP60493|RL27_THET8 Large ribosomal subunit protein bL27 (Gene Name=rpmA)

[Back to BioLiP]