Structure of PDB 4v68 Chain B0

Receptor sequence

>4v68B0 (length=85) Species: 274 (Thermus thermophilus)

MAHKKGLGSTRNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKN
VGMGRDFTLFALVDGVVEFQDRGRLGRYVHVRPLA

3D structure

• PDB: 4v68 GTPase activation of elongation factor EF-Tu by the ribosome during decoding
• Chain: B0
• Resolution: 6.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B0	M1 K5 L7	M1 K5 L7
BS02	rna	B0	M1 A2 N12 R14 S16 Q17 A18 K19 R20 K24 Y26 E27 Q29 R32 A33 G34 N35 I36 R39 R41 G42 T43 F45 G54 R55 F57 F60 F69 R77	M1 A2 N12 R14 S16 Q17 A18 K19 R20 K24 Y26 E27 Q29 R32 A33 G34 N35 I36 R39 R41 G42 T43 F45 G54 R55 F57 F60 F69 R77
BS03	rna	B0	R72 R74	R72 R74

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v68, PDBe:4v68, PDBj:4v68
• PDBsum: 4v68
• PubMed: 19229291
• UniProt: P60493|RL27_THET8 Large ribosomal subunit protein bL27 (Gene Name=rpmA)