Structure of PDB 4v5m Chain B0

Receptor sequence

>4v5mB0 (length=84) Species: 300852 (Thermus thermophilus HB8)

AHKKGLGSTRNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKNV
GMGRDFTLFALVDGVVEFQDRGRLGRYVHVRPLA

3D structure

• PDB: 4v5m Head Swivel on the Ribosome Facilitates Translocation by Means of Intra-Subunit tRNA Hybrid Sites.
• Chain: B0
• Resolution: 7.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B0	H3 N12 R14 D15 S16 Q17 R20 V23 K24 Y26 E27 G28 Q29 R32 A33 G34 N35 I36 R39 R41 G42 T43 F45 G54 R55 D56 F57 F60 F69 L75 R77	H2 N11 R13 D14 S15 Q16 R19 V22 K23 Y25 E26 G27 Q28 R31 A32 G33 N34 I35 R38 R40 G41 T42 F44 G53 R54 D55 F56 F59 F68 L74 R76
BS02	rna	B0	R72 R74 L75	R71 R73 L74

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v5m, PDBe:4v5m, PDBj:4v5m
• PDBsum: 4v5m
• PubMed: 21124459
• UniProt: P60493|RL27_THET8 Large ribosomal subunit protein bL27 (Gene Name=rpmA)