Structure of PDB 4v5a Chain B0

Receptor sequence
>4v5aB0 (length=85) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MAHKKALASTRNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKN
VGMGRDFTLFALVDGVVEFQDRGRLGRYVHVRPLA
3D structure
PDB4v5a Crystal structure of the ribosome recycling factor bound to the ribosome.
ChainB0
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B0 M1 A2 H3 K5 N12 R14 S16 Q17 A18 K19 R20 K24 R25 Y26 E27 Q29 R32 A33 G34 N35 I36 R39 R41 G42 T43 R44 R55 D56 F69 R77 M1 A2 H3 K5 N12 R14 S16 Q17 A18 K19 R20 K24 R25 Y26 E27 Q29 R32 A33 G34 N35 I36 R39 R41 G42 T43 R44 R55 D56 F69 R77
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v5a, PDBe:4v5a, PDBj:4v5a
PDBsum4v5a
PubMed17660830
UniProtP60493|RL27_THET8 Large ribosomal subunit protein bL27 (Gene Name=rpmA)

[Back to BioLiP]