Structure of PDB 4v4r Chain B0

Receptor sequence
>4v4rB0 (length=86) Species: 274 (Thermus thermophilus) [Search protein sequence]
AHKKGVGSSKNGRDSNPKYLGVKKFGGEVVKAGNILVRQRGTKFKAGQGV
GMGRDHTLFALSDGKVVFINKGKGARFISIEAAQTE
3D structure
PDB4v4r Crystal Structures of the Ribosome in Complex with Release Factors RF1 and RF2 Bound to a Cognate Stop Codon.
ChainB0
Resolution5.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B0 M53 R55 M52 R54
BS02 rna B0 K4 K5 K11 N12 R14 N17 K19 Y20 L21 V23 K24 K25 F26 V30 V31 K32 V38 R39 Q40 V51 D56 I70 N71 K3 K4 K10 N11 R13 N16 K18 Y19 L20 V22 K23 K24 F25 V29 V30 K31 V37 R38 Q39 V50 D55 I69 N70
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v4r, PDBe:4v4r, PDBj:4v4r
PDBsum4v4r
PubMed16377566
UniProtQ9RY65|RL27_DEIRA Large ribosomal subunit protein bL27 (Gene Name=rpmA)

[Back to BioLiP]