Structure of PDB 9iq9 Chain B

Receptor sequence

>9iq9B (length=275) Species: 1914 (Streptomyces lavendulae)

MIDLIVSQGRVADRAAWMIEGAARTARALEERYGLKGHYVGEPAPHADDD
WSVALPQARETLVAVREAATESIKGDNLTVLVNNTCSVSLATLPVVAREH
PDAVVLYIDGHGDFNTPETTDTGYLGGMVLSGACGLWDSGHGAGLRPEQA
VLVGSRDIDEGERELIRKAGVRVIPPGEATAQAVLDAVKDAPVWIHIDWD
VLEPGSIPADYTVPDGMLPAQIRAVFEAIPAERLIGVELAELNAPADSER
AEQAVAVILDMVAPAFDAAAARPLE

3D structure

• PDB: 9iq9 Copper inactivates DcsB by oxidation of the Cys86 to cysteine sulfinic aicd
• Chain: B
• Resolution: 1.58 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CU1	B	D109 D113	D109 D113
BS02	CU1	B	D109 H111 D200	D109 H111 D200
BS03	CU1	B	C86 H196	C86 H196

Gene Ontology

Molecular Function

• GO:0004053 arginase activity
• GO:0016787 hydrolase activity
• GO:0016813 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines
• GO:0030145 manganese ion binding
• GO:0046872 metal ion binding

Biological Process

• GO:0017000 antibiotic biosynthetic process
• GO:0019547 arginine catabolic process to ornithine

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:9iq9, PDBe:9iq9, PDBj:9iq9
• PDBsum: 9iq9
• UniProt: D2Z025|DCSB_STRLA N(omega)-hydroxy-L-arginine amidinohydrolase (Gene Name=dcsB)