Structure of PDB 9fgp Chain B |
>9fgpB (length=140) Species: 9606 (Homo sapiens) [Search protein sequence] |
SMDNFLTALAMREEDNRSGKLSSVIFIRDRNSHGQEISGYIDYAHRLKTE DFEVYFTGKKRLLPRPTDISFYNWDADIAVSNSSPNYQVIADNPEGLLFR YKRDRKILNVDPKAQPGDNSTRITILTELYVQAVIFDHIS |
|
PDB | 9fgp cilia and flagella associated protein 299 |
Chain | B |
Resolution | 1.49 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
B |
R117 E125 |
R28 E36 |
|
|
|