Structure of PDB 9fe5 Chain B

Receptor sequence

>9fe5B (length=418) Species: 224324 (Aquifex aeolicus VF5)

RSYPAIPRIYAETTLNMLLKRAKKPRVHSIDEYLKDGGYQALEKALNMSP
EEIIDWVDKSTLRGGGGAGFPTGKKWKFAVQNPGPRYFICNADESEPGTF
KDRIIIERDPHLLIEGIIISSYAIGANEAYIYIRGEYPAGYYILRDAIEE
AKKKGFLGKNILGSGFDLEIYVARGAGAYICGEETALIESLEGKRGHPRL
KPPYPVQKGLWGKPTVVNNVETIANVPFIISMGWEEYRYIGPSDYAGPKL
FPVSGKVKKPGVYELPMNTTLREVIFKYAGGTLGNKKVKAVFSGALDCFS
SEELDIPMDYSPLGFGGTGTVIVLTEEDDIVEAALKIAEFYEHETCGQCT
PCRVGCYEQANLLEKIYKGEATEQDWEGFDFVNRNIQPTSICGLGAVAGR
LIRQTLEKFPEEWEKYRK

3D structure

• PDB: 9fe5 Structural robustness of the NADH binding site in NADH:ubiquinone oxidoreductase (complex I).
• Chain: B
• Resolution: 2.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	B	P199 T346 C347 G348 Q349 C350 C353 I392 C393 L395 G396	P198 T345 C346 G347 Q348 C349 C352 I391 C392 L394 G395
BS02	FNR	B	G65 G67 K76 N92 E95 Y180 G183 E184 V218 N219 N220 T223	G64 G66 K75 N91 E94 Y179 G182 E183 V217 N218 N219 T222
BS03	NAI	B	G67 G68 A69 F71 K76 F79 E97 Y180 E185 Y205 T319	G66 G67 A68 F70 K75 F78 E96 Y179 E184 Y204 T318

Gene Ontology

Molecular Function

• GO:0046872 metal ion binding
• GO:0048038 quinone binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:1902600 proton transmembrane transport

External links

• PDB: RCSB:9fe5, PDBe:9fe5, PDBj:9fe5
• PDBsum: 9fe5
• PubMed: 38960077
• UniProt: O66841|NUOF_AQUAE NADH-quinone oxidoreductase subunit F (Gene Name=nuoF)