Structure of PDB 9esm Chain B

Receptor sequence

>9esmB (length=178) Species: 2242 (Halobacterium salinarum)

QVGIGTLIVFIAMVLVAAIAAGVLINTAGYLQSKGSATGEEASAQVSNRI
NIVSAYGNVAAAAVDYVNLTVRQAAGADNINLAKSTIQWIGPDAATTLTY
AAAAAAENFTTASIKGAAAAVLVDQSDRIKVIMYAAAVAAALAAGAEVQL
TVTTQYGSKTTYWAQVPESLKDKNAVAL

3D structure

• PDB: 9esm Perturbed N-glycosylation of Halobacterium salinarum archaellum filaments leads to filament bundling and compromised cell motility.
• Chain: B
• Resolution: 3.06 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BGC	B	N93 X95	N81 X83

External links

• PDB: RCSB:9esm, PDBe:9esm, PDBj:9esm
• PDBsum: 9esm
• PubMed: 38992036