Structure of PDB 9bc3 Chain B

Receptor sequence
>9bc3B (length=431) Species: 9606 (Homo sapiens) [Search protein sequence]
MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNY
EASVDSLTFSVVTGPAPSQEAGTKARFPLRDWTATVVDQQDCTLSLQLTT
PANAPIGLYRLSLEASTGYQGSSFVLGHFILLFNAWCPADAVYLDSEEER
QEYVLTQQGFIYQGSAKFIKNIPWNFGQFEDGILDICLILLDVNPKFLKN
AGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGRWDNNYGDGVSPMSWIG
SVDILRRWKNHGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTNYNSAHD
QNSNLLIEYFRSEMIWNFHCWVESWMTRPDLQPGYEGWQALDPTPQEKSE
GTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIQQDDGSVHKSI
NRSLIVGLKISTKSVGRDEREDITHTYKYPE
3D structure
PDB9bc3 Structural and mechanistic analysis of Ca 2+ -dependent regulation of transglutaminase 2 activity using a Ca 2+ -bound intermediate state.
ChainB
Resolution2.52 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B K176 W241 M252 Q276 C277 W278 N302 I331 W332 N333 F334 K170 W235 M246 Q270 C271 W272 N296 I315 W316 N317 F318
BS02 CA B G226 N229 C230 N231 D233 G220 N223 C224 N225 D227
BS03 CA B D306 N308 N310 L312 E314 E329 D300 N302 N304 L306 E308 E313
Gene Ontology
Molecular Function
GO:0003810 protein-glutamine gamma-glutamyltransferase activity
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0008233 peptidase activity
GO:0016746 acyltransferase activity
GO:0046872 metal ion binding
GO:0050568 protein-glutamine glutaminase activity
GO:0120294 peptide serotonyltransferase activity
GO:0120295 histone serotonyltransferase activity
GO:0120296 peptide dopaminyltransferase activity
GO:0120297 histone dopaminyltransferase activity
GO:0120298 peptide noradrenalinyltransferase activity
GO:0120299 peptide histaminyltransferase activity
Biological Process
GO:0006338 chromatin remodeling
GO:0006508 proteolysis
GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0010467 gene expression
GO:0014046 dopamine secretion
GO:0018149 peptide cross-linking
GO:0018277 protein deamination
GO:0032471 negative regulation of endoplasmic reticulum calcium ion concentration
GO:0042981 regulation of apoptotic process
GO:0043065 positive regulation of apoptotic process
GO:0043277 apoptotic cell clearance
GO:0043547 positive regulation of GTPase activity
GO:0045785 positive regulation of cell adhesion
GO:0050769 positive regulation of neurogenesis
GO:0051057 positive regulation of small GTPase mediated signal transduction
GO:0051561 positive regulation of mitochondrial calcium ion concentration
GO:0060348 bone development
GO:0060445 branching involved in salivary gland morphogenesis
GO:0060662 salivary gland cavitation
GO:0071314 cellular response to cocaine
GO:1903351 cellular response to dopamine
GO:1903672 positive regulation of sprouting angiogenesis
GO:1904015 cellular response to serotonin
GO:2000425 regulation of apoptotic cell clearance
Cellular Component
GO:0000785 chromatin
GO:0000786 nucleosome
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005783 endoplasmic reticulum
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0005925 focal adhesion
GO:0031012 extracellular matrix
GO:0048471 perinuclear region of cytoplasm
GO:0062023 collagen-containing extracellular matrix
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:9bc3, PDBe:9bc3, PDBj:9bc3
PDBsum9bc3
PubMed38959038
UniProtP21980|TGM2_HUMAN Protein-glutamine gamma-glutamyltransferase 2 (Gene Name=TGM2)

[Back to BioLiP]