Structure of PDB 8x2l Chain B

Receptor sequence

>8x2lB (length=525) Species: 9606 (Homo sapiens)

EGLSIFVILVWLGLNVFLFVWYYRVYDIPPKFFYTRKLLGSALALARAPA
ACLNFNCMLILLPVCRNLLSFLRGSSTRVRRQLDRNLTFHKMVAWMIALH
SAIHTIAHLFNVEWCVNARVNNSDPYSVALSELGDRQNESYLNFARKRIK
NPEGGLYLAVTLLAGITGVVITLCLILIITSSTKTIRRSYFEVFWYTHHL
FVIFFIGLAIHGAERIVRGQTAESLAVHNITVCEQKISEWGKIKECPIPQ
FAGNPPMTWKWIVGPMFLYLCERLVRFWRSQQKVVITKVVTHPFKTIELQ
MKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGDW
TEGLFNACGCDKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASI
LKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERN
NAGFLSYNIYLTGQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALA
ETLSKQSISNSESGPRGVHFIFNKE

3D structure

• PDB: 8x2l Activation mechanism of phagocyte NADPH oxidase by cytosolic factors
• Chain: B
• Resolution: 2.99 Å

Enzymatic activity

• Enzyme Commision number: 1.-.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	B	R199 S200 F202 Y324 H338 P339 F340 T341 R356 G359 D360 W361 T362	R188 S189 F191 Y313 H327 P328 F329 T330 R345 G348 D349 W350 T351
BS02	HEM	B	A57 L60 S112 H115 T116 H119 G179 I182 T183 F215 L219 H222 G223 R226 V228 P267 M268 T269	A50 L53 S101 H104 T105 H108 G168 I171 T172 F204 L208 H211 G212 R215 V217 P256 M257 T258
BS03	HEM	B	I67 V71 L98 H101 A105 S193 R198 F202 F205 W206 H209 F212 Y280 R287	I60 V64 L87 H90 A94 S182 R187 F191 F194 W195 H198 F201 Y269 R276
BS04	MG	B	E203 D360	E192 D349

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0009055 electron transfer activity
• GO:0016175 superoxide-generating NAD(P)H oxidase activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding
• GO:0046982 protein heterodimerization activity
• GO:0050660 flavin adenine dinucleotide binding
• GO:0050664 oxidoreductase activity, acting on NAD(P)H, oxygen as acceptor

Biological Process

• GO:0006801 superoxide metabolic process
• GO:0006952 defense response
• GO:0006954 inflammatory response
• GO:0007584 response to nutrient
• GO:0009410 response to xenobiotic stimulus
• GO:0032760 positive regulation of tumor necrosis factor production
• GO:0034220 monoatomic ion transmembrane transport
• GO:0042554 superoxide anion generation
• GO:0045087 innate immune response
• GO:0045730 respiratory burst
• GO:0045766 positive regulation of angiogenesis
• GO:0050665 hydrogen peroxide biosynthetic process
• GO:0071276 cellular response to cadmium ion
• GO:0071361 cellular response to ethanol
• GO:0071456 cellular response to hypoxia
• GO:0097411 hypoxia-inducible factor-1alpha signaling pathway
• GO:1904044 response to aldosterone
• GO:1904845 cellular response to L-glutamine
• GO:1990776 response to angiotensin

Cellular Component

• GO:0005635 nuclear envelope
• GO:0005737 cytoplasm
• GO:0005789 endoplasmic reticulum membrane
• GO:0005886 plasma membrane
• GO:0016020 membrane
• GO:0030425 dendrite
• GO:0030670 phagocytic vesicle membrane
• GO:0034702 monoatomic ion channel complex
• GO:0035579 specific granule membrane
• GO:0043020 NADPH oxidase complex
• GO:0043025 neuronal cell body
• GO:0045335 phagocytic vesicle
• GO:0070821 tertiary granule membrane
• GO:0097038 perinuclear endoplasmic reticulum

External links

• PDB: RCSB:8x2l, PDBe:8x2l, PDBj:8x2l
• PDBsum: 8x2l
• PubMed: 38355798
• UniProt: P04839|CY24B_HUMAN Cytochrome b-245 heavy chain (Gene Name=CYBB)