Structure of PDB 8wtc Chain B

Receptor sequence

>8wtcB (length=100) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

QISACPKCGMTFQQFRKIGRFGCSECYKTFHSNITPILRKVHSGNTVHAG
KIPKRIGGNLHVRRQIDMLKKELESLIHQEEFENAAHVRDQIRLLEQSLK

3D structure

• PDB: 8wtc Structural insights into the regulation of protein-arginine kinase McsB by McsA.
• Chain: B
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	B	C99 E101 C102	C23 E25 C26

Gene Ontology

Molecular Function

• GO:0005507 copper ion binding
• GO:0008270 zinc ion binding
• GO:0046870 cadmium ion binding
• GO:0050897 cobalt ion binding

Biological Process

• GO:0006508 proteolysis
• GO:1990169 stress response to copper ion
• GO:1990170 stress response to cadmium ion

External links

• PDB: RCSB:8wtc, PDBe:8wtc, PDBj:8wtc
• PDBsum: 8wtc
• PubMed: 38625935
• UniProt: P37569|MCSA_BACSU Protein-arginine kinase activator protein (Gene Name=mcsA)