Structure of PDB 8we8 Chain B |
>8we8B (length=60) Species: 8620 (Dendroaspis polylepis polylepis) [Search protein sequence] |
RICYIHKASLPRATKTCVENTCYKMFIRTQREYISERGCGCPTAMWPYQT ECCKGDRCNK |
|
PDB | 8we8 Structural basis for human Ca v 1.2 inhibition by multiple drugs and the neurotoxin calciseptine. |
Chain | B |
Resolution | 2.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CLR |
B |
T43 M45 |
T43 M45 |
|
|
|
|