Structure of PDB 8w9e Chain B

Receptor sequence
>8w9eB (length=385) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
VYEATPFDPITVKPSDKRRVAYFYDADVGNYAYGAGHPMKPHRIRMAHSL
IMNYGLYKKMEIYRAKPATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRES
VKFNVGDDCPVFDGLYEYCSISGGGSMEGAARLNRGKCDVAVNYAGGLHH
AKKSEASGFCYLNDIVLGIIELLRYHPRVLYIDIDVHHGDGVEEAFYTTD
RVMTCSFHKYGEFFPGTGELRDIGVGAGKNYAVNVPLRDGIDDATYRSVF
EPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVNYVKSF
GIPMMVVGGGGYTMRNVARTWCFETGLLNNVVLDKDLPYNEYYEYYGPDY
KLSVRPSNMFNVNTPEYLDKVMTNIFANLENTKYA
3D structure
PDB8w9e Structures and dynamics of Rpd3S complex bound to nucleosome.
ChainB
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.5.1.98: histone deacetylase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN B D186 H188 D274 D185 H187 D273
Gene Ontology
Molecular Function
GO:0003713 transcription coactivator activity
GO:0003714 transcription corepressor activity
GO:0004407 histone deacetylase activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0016787 hydrolase activity
Biological Process
GO:0000082 G1/S transition of mitotic cell cycle
GO:0000086 G2/M transition of mitotic cell cycle
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006368 transcription elongation by RNA polymerase II
GO:0006979 response to oxidative stress
GO:0006995 cellular response to nitrogen starvation
GO:0016239 positive regulation of macroautophagy
GO:0016479 negative regulation of transcription by RNA polymerase I
GO:0030174 regulation of DNA-templated DNA replication initiation
GO:0031507 heterochromatin formation
GO:0034503 protein localization to nucleolar rDNA repeats
GO:0034605 cellular response to heat
GO:0044804 nucleophagy
GO:0045128 negative regulation of reciprocal meiotic recombination
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0051321 meiotic cell cycle
GO:0061186 negative regulation of silent mating-type cassette heterochromatin formation
GO:0061188 negative regulation of rDNA heterochromatin formation
GO:0070550 rDNA chromatin condensation
Cellular Component
GO:0000118 histone deacetylase complex
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0032221 Rpd3S complex
GO:0033698 Rpd3L complex
GO:0034399 nuclear periphery
GO:0070210 Rpd3L-Expanded complex
GO:0070211 Snt2C complex
GO:0070822 Sin3-type complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8w9e, PDBe:8w9e, PDBj:8w9e
PDBsum8w9e
PubMed38598631
UniProtP32561|RPD3_YEAST Histone deacetylase RPD3 (Gene Name=RPD3)

[Back to BioLiP]