Structure of PDB 8w2o Chain B

Receptor sequence
>8w2oB (length=178) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
KFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYRNKARDIINKHNHK
RRHIGKRGRKERENSSQNETLKVTCLSNKEKRHIMHVKKMNQKELAQTSI
DTLKLLYDGSPGYSKVFVDANRFDIGDLVKRAQTSRSRDETCESNPFPRL
NNPKKLEPPKILSQWSNTIPKTSIFYSV
3D structure
PDB8w2o Selected humanization of yeast U1 snRNP leads to global suppression of pre-mRNA splicing and mitochondrial dysfunction in the budding yeast.
ChainB
Resolution3.49 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B T11 H24 G27 T9 H22 G25
BS02 rna B H15 D36 Y37 R39 N40 K41 R43 H49 H51 K52 R54 H55 G57 K58 G60 R61 K62 E63 R64 C77 N80 K83 R84 M87 H13 D34 Y35 R37 N38 K39 R41 H47 H49 K50 R52 H53 G55 K56 G58 R59 K60 E61 R62 C75 N78 K81 R82 M85
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0008270 zinc ion binding
GO:0030619 U1 snRNA binding
GO:0030627 pre-mRNA 5'-splice site binding
GO:0046872 metal ion binding
Biological Process
GO:0000387 spliceosomal snRNP assembly
GO:0000395 mRNA 5'-splice site recognition
GO:0000398 mRNA splicing, via spliceosome
Cellular Component
GO:0000243 commitment complex
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005685 U1 snRNP
GO:0071004 U2-type prespliceosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8w2o, PDBe:8w2o, PDBj:8w2o
PDBsum8w2o
PubMed38688558
UniProtQ05900|RU1C_YEAST U1 small nuclear ribonucleoprotein C (Gene Name=YHC1)

[Back to BioLiP]