Structure of PDB 8vy8 Chain B

Receptor sequence
>8vy8B (length=75) Species: 8616 (Bungarus multicinctus) [Search protein sequence]
GIVCHTTATSPISAVTCPPGENLCYRKMWCDVFCSSRGKVVELGCAATCP
SKKPYEEVTCCSTDKCNPHPKQRPG
3D structure
PDB8vy8 Structure of recombinant alpha bungarotoxin complexed with HAP peptide at 2.4 Angstroms resolution.
ChainB
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B T6 A7 T8 S9 I11 M27 D30 R36 G37 K38 V39 V40 H68 K70 Q71 T7 A8 T9 S10 I12 M28 D31 R37 G38 K39 V40 V41 H69 K71 Q72
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0030550 acetylcholine receptor inhibitor activity
GO:0090729 toxin activity
GO:0099106 ion channel regulator activity
Biological Process
GO:0035821 modulation of process of another organism
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8vy8, PDBe:8vy8, PDBj:8vy8
PDBsum8vy8
PubMed38347541
UniProtP60615|3L21A_BUNMU Alpha-bungarotoxin

[Back to BioLiP]