Structure of PDB 8vm2 Chain B

Receptor sequence
>8vm2B (length=176) Species: 9606 (Homo sapiens) [Search protein sequence]
LYFQGMTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVV
IDGETCLLDILDTAGKEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINL
YREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETS
AKTRQGVEDAFYTLVREIRQYRMKKL
3D structure
PDB8vm2 Crystal structure of NRAS Q61K with a ligand-induced pocket near switch II.
ChainB
Resolution1.74 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.5.2: small monomeric GTPase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GTP B R97 E98 K101 R102 E103 K106
BS02 GTP B G13 V14 G15 K16 S17 A18 F28 V29 D30 Y32 P34 T35 G60 N116 K117 D119 S145 A146 G18 V19 G20 K21 S22 A23 F33 V34 D35 Y37 P39 T40 G65 N121 K122 D124 S150 A151
BS03 MG B S17 T35 S22 T40
BS04 GTP B G60 E62 R68 K88 D92 L95 Y96 G65 E67 R73 K93 D97 L100 Y101
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0003925 G protein activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
GO:0019003 GDP binding
GO:0044877 protein-containing complex binding
Biological Process
GO:0000165 MAPK cascade
GO:0001938 positive regulation of endothelial cell proliferation
GO:0007165 signal transduction
GO:0007265 Ras protein signal transduction
GO:0045445 myoblast differentiation
Cellular Component
GO:0000139 Golgi membrane
GO:0005789 endoplasmic reticulum membrane
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0070062 extracellular exosome
GO:0070821 tertiary granule membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8vm2, PDBe:8vm2, PDBj:8vm2
PDBsum8vm2
PubMed38640594
UniProtP01111|RASN_HUMAN GTPase NRas (Gene Name=NRAS)

[Back to BioLiP]