Structure of PDB 8v84 Chain B

Receptor sequence

>8v84B (length=331) Species: 1390929 (Saccharomyces cerevisiae BY4741-AV16) [Search protein sequence]

GHLGFLPRKRAASIRARVKAFPKDDRSKPVALTSFLGYKAGMTTIVRDLD
RPGSKFHKREVVEAVTVVDTPPVVVVGVVGYVETPRGLRSLTTVWAEHLS
DEVKRRFYKNWYKSKKKAFTKYSAKYAQDGAGIERELARIKKYASVVRVL
VHTQIRKTPLAQKKAHLAEIQLNGGSISEKVDWAREHFEKTVAVDSVFEQ
NEMIDAIAVTKGHGGYHSRTSINHKIYRVGKGDDEANGATSFDRTKKTIT
PMGGFVHYGEIKNDFIMVKGCIPGNRKRIVTLRKSLYTNTSRKALEEVSL
KWIDTASKFGKGRFQTPAEKHAFMGTLKKDL

3D structure

PDB

8v84 The DEAD-box ATPase Dbp10/DDX54 initiates peptidyl transferase center formation during 60S ribosome biogenesis.

Chain

Resolution

2.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B	H13 L14 G15 P18 K20 R21 R26 R28 K30 A31 K50 M53 T55 R62 G64 S65 Y92 T95 R97 L99 R100 L102 T104 W106 R116 F118 Y119 K120 N121 Y123 K124 S125 K126 K128 F130 K132 Y133 R150 Y154 R159 Q173 K174 K175 E180 T221 K222 G223 H224 G225 Y272 S274 R275 N279 M308 G309 H313 G315 C327 P329 G330 N331 K333 R334 L342 Y343 R348 S363 F365 K367 K376 M380 L383 K384	H2 L3 G4 P7 K9 R10 R15 R17 K19 A20 K39 M42 T44 R51 G53 S54 Y81 T84 R86 L88 R89 L91 T93 W95 R105 F107 Y108 K109 N110 Y112 K113 S114 K115 K117 F119 K121 Y122 R139 Y143 R148 Q162 K163 K164 E169 T210 K211 G212 H213 G214 Y216 S218 R219 N223 M252 G253 H257 G259 C271 P273 G274 N275 K277 R278 L286 Y287 R292 S307 F309 K311 K320 M324 L327 K328

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006364	rRNA processing
GO:0006412	translation
GO:0006414	translational elongation
GO:1990145	maintenance of translational fidelity

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8v84, PDBe:8v84, PDBj:8v84
PDBsum	8v84
PubMed	38632236
UniProt	P14126\|RL3_YEAST Large ribosomal subunit protein uL3 (Gene Name=RPL3)

[Back to BioLiP]