Structure of PDB 8urk Chain B

Receptor sequence

>8urkB (length=249) Species: 95486 (Burkholderia cenocepacia) [Search protein sequence]

LPSGIELHNRDFLTDAAHLPDASIDLIVADPPYGLGKDYGNDSDKRSGDD
FLAWTREWLELAIPKLKPSGSMYIFCTWQYAPEIFSFLKTQLTMVNEIIW
DRRVPSMGGTTRRFTSVHDNIGFFAVSRAYYFDLDPVRIPYDADTKKARS
RKLFEGSKWLEMGYNPKDVWSVSRLHRQHAERVDHPTQKPLEIIERMVLA
SCPPGGRVLDPFMGSGTTAVACARQGRDFVGYEINESYCAIAHERVNAL

3D structure

PDB

8urk Burkholderia cenocepacia epigenetic regulator M.BceJIV simultaneously engages two DNA recognition sequences for methylation.

Chain

Resolution

2.11 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	B	R167 Y170 R178 F183 K187 W188 N194 K196	R138 Y141 R149 F154 K158 W159 N165 K167
BS02	dna	B	D59 P60 P61 Y62 L64 K66 Y68 D73 W107 Q108 R131 V133 S135 M136 G137 G138 T139 R141 R142 S145 D148 R203 H205 R206 Q207 R211 T216 K218	D30 P31 P32 Y33 L35 K37 Y39 D44 W78 Q79 R102 V104 S106 M107 G108 G109 T110 R112 R113 S116 D119 R174 H176 R177 Q178 R182 T187 K189
BS03	dna	B	R132 V133 P134 M136 G137 G138 T144 H205 Q207 H208	R103 V104 P105 M107 G108 G109 T115 H176 Q178 H179
BS04	FRU	B	K118 M123	K89 M94
BS05	FRU	B	M136 G137	M107 G108
BS06	SFG	B	R39 D40 D59 Y68 S72 H214 T216 F241 G243 S244 T246 Y261 E262 I263 Y267	R10 D11 D30 Y39 S43 H185 T187 F212 G214 S215 T217 Y232 E233 I234 Y238

External links

PDB	RCSB:8urk, PDBe:8urk, PDBj:8urk
PDBsum	8urk
PubMed	39244607
UniProt	A0A8I1DKW0

[Back to BioLiP]