Structure of PDB 8ur2 Chain B

Receptor sequence

>8ur2B (length=99) Species: 412133 (Trichomonas vaginalis G3)

SMPALVIKTNAKFTEEEKSKATEELGNIVSKVLGKPISYVMVTLEDGVAV
RFGGSDEKAAFMSLMSILNRAVNKRASAALTKWFTDHGFQGDRIYIVFN

3D structure

• PDB: 8ur2 Crystal Structure of macrophage migration inhibitory factor (MIF) from Trichomonas vaginalis (I41 form)
• Chain: B
• Resolution: 1.9 Å

Enzymatic activity

• Enzyme Commision number: 5.3.2.1: phenylpyruvate tautomerase.
  5.3.3.12: L-dopachrome isomerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PYR	B	N22 D68	N10 D56

Gene Ontology

Molecular Function

• GO:0005125 cytokine activity
• GO:0050178 phenylpyruvate tautomerase activity

Biological Process

• GO:0007165 signal transduction

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space

External links

• PDB: RCSB:8ur2, PDBe:8ur2, PDBj:8ur2
• PDBsum: 8ur2
• UniProt: A2DXT4