Structure of PDB 8um6 Chain B |
>8um6B (length=128) Species: 1423 (Bacillus subtilis) [Search protein sequence] |
HVSVKPAESAAGSWETYTMKVPSEKNLPTTKVVLKMPKDVEFQQYEPIPG WKVSTQKHDDKSVSVTWEATDGGIQEGQFQQFTFVAKNPDKAEEAAWDAY QYYKDGSIVEFTGDEDADTPHSITNITS |
|
PDB | 8um6 Stabilization of a Cu-binding site by a highly conserved tryptophan residue |
Chain | B |
Resolution | 1.95 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
B |
H27 E50 |
H1 E24 |
|
|
|