Structure of PDB 8u8m Chain B |
>8u8mB (length=116) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] |
SDVEISDSFEKAMWNHVSQNAARLTGKFLMTEQFWAELLQSQPNIPIKSA HIVLHHFNEMMLENLWKQAMDPDAKLQILKDLSVPLSYHQRKWILDNDRL DVALSLDGYVVSWDIV |
|
PDB | 8u8m Caenorhabditis elegans telomere-binding proteins TEBP-1 and TEBP-2 adapt the Myb module to dimerize and bind telomeric DNA |
Chain | B |
Resolution | 2.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CO |
B |
H216 H220 |
H51 H55 |
|
|
|