Structure of PDB 8ttl Chain B |
>8ttlB (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] |
QSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVS GDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQG |
|
PDB | 8ttl Structures of AT8 and PHF1 phosphomimetic tau: Insights into the posttranslational modification code of tau aggregation. |
Chain | B |
Resolution | 2.6 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
B |
H388 E391 |
H38 E41 |
|
|
|