Structure of PDB 8tic Chain B

Receptor sequence

>8ticB (length=331) Species: 9606 (Homo sapiens)

PEAYWNREQEKLNRQYNPILSMLISHLNYCEPDLRVTSVVTGFNNLPDRF
KDFLLYLRCRNYSLLIDQPDKCAKKPFLLLAIKSLTPHFARRQAIRESWG
QESNAGNQTVVRVFLLGQTPPEDNHPDLSDMLKFESEKHQDILMWNYRDT
FFNLSLKEVLFLRWVSTSCPDTEFVFKGDDDVFVNTHHILNYLNSLSKTK
AKDLFIGDVIHNAGPHRDKKLKYYIPEVVYSGLYPPYAGGGGFLYSGHLA
LRLYHITDQVHLYPIDDVYTGMCLQKLGLVPEKHKGFRTFDIEEKNKNNI
CSYVDLMLVHSRKPQEMIDIWSQLQSAHLKC

3D structure

• PDB: 8tic Imidazolone as an Amide Bioisostere in the Development of beta-1,3- N -Acetylglucosaminyltransferase 2 (B3GNT2) Inhibitors.
• Chain: B
• Resolution: 2.7 Å

Enzymatic activity

• Enzyme Commision number: 2.4.1.149: N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FKX	B	K149 L151 D215 F217 L220 K223 D245 D246 K288	K83 L85 D149 F151 L154 K157 D179 D180 K222

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0008499 UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase activity
• GO:0008532 N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase activity
• GO:0016757 glycosyltransferase activity
• GO:0016758 hexosyltransferase activity

Biological Process

• GO:0006486 protein glycosylation
• GO:0006493 protein O-linked glycosylation
• GO:0007411 axon guidance
• GO:0007608 sensory perception of smell
• GO:0016266 O-glycan processing
• GO:0018146 keratan sulfate biosynthetic process
• GO:0030311 poly-N-acetyllactosamine biosynthetic process
• GO:1990830 cellular response to leukemia inhibitory factor

Cellular Component

• GO:0000139 Golgi membrane
• GO:0005794 Golgi apparatus
• GO:0016020 membrane

External links

• PDB: RCSB:8tic, PDBe:8tic, PDBj:8tic
• PDBsum: 8tic
• PubMed: 37988652
• UniProt: Q9NY97|B3GN2_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 (Gene Name=B3GNT2)