Structure of PDB 8thy Chain B

Receptor sequence

>8thyB (length=370) Species: 4930 (Saccharomyces)

AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVG
DEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLL
TEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDS
GDGVTHVVPIYEGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAE
REIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITIGNERF
RAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTM
FPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLTTFQQM
WISKQEYDESGPSIVHHKCF

3D structure

• PDB: 8thy yeast actin A167E mutant rabbit-like
• Chain: B
• Resolution: 3.84 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ADP	B	G13 S14 M16 K18 G156 D157 R210 K213 E214 G302 M305 F306 K336	G8 S9 M11 K13 G151 D152 R205 K208 E209 G297 M300 F301 K331
BS02	MG	B	D11 Q137	D6 Q132

Gene Ontology

Molecular Function

• GO:0005200 structural constituent of cytoskeleton
• GO:0005524 ATP binding
• GO:0016787 hydrolase activity
• GO:0016887 ATP hydrolysis activity
• GO:0042802 identical protein binding

Biological Process

• GO:0000011 vacuole inheritance
• GO:0006281 DNA repair
• GO:0006338 chromatin remodeling
• GO:0006897 endocytosis
• GO:0009306 protein secretion
• GO:0030010 establishment of cell polarity
• GO:0030476 ascospore wall assembly
• GO:1902404 mitotic actomyosin contractile ring contraction

Cellular Component

• GO:0000142 cellular bud neck contractile ring
• GO:0000785 chromatin
• GO:0000812 Swr1 complex
• GO:0005576 extracellular region
• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005856 cytoskeleton
• GO:0005884 actin filament
• GO:0030479 actin cortical patch
• GO:0031011 Ino80 complex
• GO:0032432 actin filament bundle
• GO:0035267 NuA4 histone acetyltransferase complex
• GO:0062040 fungal biofilm matrix

External links

• PDB: RCSB:8thy, PDBe:8thy, PDBj:8thy
• PDBsum: 8thy
• UniProt: P60009|ACT_CANGA Actin (Gene Name=ACT1)