Structure of PDB 8tbn Chain B

Receptor sequence

>8tbnB (length=170) Species: 9606 (Homo sapiens)

SMTEYKLVVVGASGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGE
TCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQ
IKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTR
QGVDDAFYTLVREIRKHKEK

3D structure

• PDB: 8tbn Concurrent inhibition of oncogenic and wild-type RAS-GTP for cancer therapy
• Chain: B
• Resolution: 1.46 Å

Enzymatic activity

• Enzyme Commision number: 3.6.5.2: small monomeric GTPase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GNP	B	S12 G13 G15 K16 S17 A18 F28 V29 D30 Y32 P34 T35 G60 N116 K117 D119 L120 S145 A146	S13 G14 G16 K17 S18 A19 F29 V30 D31 Y33 P35 T36 G61 N117 K118 D120 L121 S146 A147
BS02	MG	B	S17 T35	S18 T36
BS03	ZNI	B	P34 T35 I36 A59 Y64 M67	P35 T36 I37 A60 Y65 M68

Gene Ontology

Molecular Function

• GO:0003924 GTPase activity
• GO:0005525 GTP binding

Biological Process

• GO:0007165 signal transduction

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:8tbn, PDBe:8tbn, PDBj:8tbn
• PDBsum: 8tbn
• PubMed: 38589574
• UniProt: P01116|RASK_HUMAN GTPase KRas (Gene Name=KRAS)