Structure of PDB 8rm7 Chain B

Receptor sequence
>8rm7B (length=73) Species: 9606 (Homo sapiens) [Search protein sequence]
QKTCLICGDEASGAHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDK
FRRKNCPSCRLRKCYEAGMTLGA
3D structure
PDB8rm7 Structural mechanism underlying variations in DNA binding by the androgen receptor.
ChainB
Resolution2.25 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B S578 R585 R608 R615 S23 R30 R53 R60
BS02 dna B G568 A569 H570 Y571 K580 K584 G13 A14 H15 Y16 K25 K29
BS03 ZN B C595 C601 C611 C614 C40 C46 C56 C59
BS04 ZN B C559 C562 C576 C579 C4 C7 C21 C24
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8rm7, PDBe:8rm7, PDBj:8rm7
PDBsum8rm7
PubMed38604378
UniProtP10275|ANDR_HUMAN Androgen receptor (Gene Name=AR)

[Back to BioLiP]