Structure of PDB 8rj9 Chain B

Receptor sequence

>8rj9B (length=214) Species: 562 (Escherichia coli)

MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAK
DIMDAGKLVTDELVIALVKERIAQEDCRNGFLLAGFPRTIPQADAMKEAG
INVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTG
EELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTK
PVAEVRADLEKILG

3D structure

• PDB: 8rj9 Insights into Enzymatic Catalysis from Binding and Hydrolysis of Diadenosine Tetraphosphate by
• Chain: B
• Resolution: 1.59 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ADP	B	P9 T31 G32 L35 R36 M53 K57 L58 V59 V64 G85 R88 Q92 R123 R156	P9 T31 G32 L35 R36 M53 K57 L58 V59 V64 G85 R88 Q92 R123 R156
BS02	ADP	B	G10 G12 K13 G14 T15 R119 R123 V132 Y133 H134 F137 V202	G10 G12 K13 G14 T15 R119 R123 V132 Y133 H134 F137 V202

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0004017 adenylate kinase activity
• GO:0004550 nucleoside diphosphate kinase activity
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0016208 AMP binding
• GO:0016301 kinase activity
• GO:0050145 nucleoside monophosphate kinase activity

Biological Process

• GO:0006172 ADP biosynthetic process
• GO:0009123 nucleoside monophosphate metabolic process
• GO:0009132 nucleoside diphosphate metabolic process
• GO:0009165 nucleotide biosynthetic process
• GO:0015951 purine ribonucleotide interconversion
• GO:0016310 phosphorylation
• GO:0044209 AMP salvage
• GO:0046940 nucleoside monophosphate phosphorylation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:8rj9, PDBe:8rj9, PDBj:8rj9
• PDBsum: 8rj9
• PubMed: 39121211
• UniProt: P69441|KAD_ECOLI Adenylate kinase (Gene Name=adk)