Structure of PDB 8r1f Chain B

Receptor sequence

MFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDL
CIVYRDGNPYAVCDKCLKFYSKISEYRHYSYSLYGTTLEQQYNKPLSDLL
IRCINCQKPLSPEEKQRHLDKKQRFHNIRGRWTGRCMSCSRS

3D structure

PDB

8r1f Monomeric E6AP-E6-p53 ternary complex

Chain

Resolution

3.67 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	B	C110 C146	C103 C139
BS02	ZN	B	C37 C73	C30 C66

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0005515	protein binding
GO:0030165	PDZ domain binding
GO:0031386	protein tag activity
GO:0042802	identical protein binding
GO:0044389	ubiquitin-like protein ligase binding
GO:0046872	metal ion binding

	Biological Process
GO:0006351	DNA-templated transcription
GO:0006355	regulation of DNA-templated transcription
GO:0016925	protein sumoylation
GO:0019049	virus-mediated perturbation of host defense response
GO:0030162	regulation of proteolysis
GO:0039502	symbiont-mediated suppression of host type I interferon-mediated signaling pathway
GO:0039548	symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of IRF3 activity
GO:0039648	symbiont-mediated perturbation of host ubiquitin-like protein modification
GO:0039653	symbiont-mediated suppression of host transcription
GO:0045944	positive regulation of transcription by RNA polymerase II
GO:0052150	symbiont-mediated perturbation of host apoptosis
GO:0090630	activation of GTPase activity

	Cellular Component
GO:0000794	condensed nuclear chromosome
GO:0005634	nucleus
GO:0005940	septin ring
GO:0030430	host cell cytoplasm
GO:0042025	host cell nucleus

External links

PDB	RCSB:8r1f, PDBe:8r1f, PDBj:8r1f
PDBsum	8r1f
PubMed
UniProt	P03126\|VE6_HPV16 Protein E6 (Gene Name=E6); Q12306\|SMT3_YEAST Ubiquitin-like protein SMT3 (Gene Name=SMT3)